McDonnell Genome Institute

Washington University

Transcript

lnc-WNT8A-4:2

Chromosome

chr5

Gene Name

lnc-WNT8A-4

Start

138033174

CPC Label

noncoding

End

138039547

Cancer

EOGC

Strand

+

Peptide

LLSYLDLLPGMRPSVNTFLDR

Modified Peptide

n[145]LLSYLDLLPGM[147]RPSVNTFLDR

Peptide Length

21

ORF Length

48

Open Reading Frame (ORF)

LLSYLDLLPGMRPSVNTFLDRNCQIFVYLFVNENQEPLRIPPNSRCWF

Conservation Score

1

PhyloCSF Frame 1

-5.232

No. of Spectra

1

CPC Coding Probability

0.211002

PhyloCSF Frame 2 

-5.16

CNTI Index

noncoding

Max Probability

0.8502

PhyloCSF Frame 3

-4.762

CNTI Score

-0.372600514