McDonnell Genome Institute

Washington University

Transcript

lnc-WNT7A-2:1

Chromosome

chr3

Gene Name

lnc-WNT7A-2

Start

13625285

CPC Label

noncoding

End

13628854

Cancer

OV

Strand

-

Peptide

AGVDLACPHPK

Modified Peptide

n[145]AGVDLACPHPK

Peptide Length

11

ORF Length

118

Open Reading Frame (ORF)

LGSRPALVRVAGPGWMKPLPLIRRLEFSSKRDRVNPLWAPPQCTNQATARGITGTQTPAGRSKAGVDLACPHPKQKRKWSYLFGARIPGRGWRIGVRIQAGDSVARTTFNGLGEVARF

Conservation Score

0.195

PhyloCSF Frame 1

-1.428

No. of Spectra

1

CPC Coding Probability

0.081176

PhyloCSF Frame 2 

-4.613

CNTI Index

noncoding

Max Probability

0.5384

PhyloCSF Frame 3

-2.987

CNTI Score

-0.370991797