McDonnell Genome Institute

Washington University

Transcript

lnc-WNT5B-3:3

Chromosome

chr12

Gene Name

lnc-WNT5B-3

Start

1494048

CPC Label

noncoding

End

1495930

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

NVTNCLLIFSNVFGK

Modified Peptide

n[145]NVTNCLLIFSNVFGK

Peptide Length

15

ORF Length

75

Open Reading Frame (ORF)

LSSPTLLARKDIHYREILLNKMAIFTYSSAKTVSRLFSVKNVTNCLLIFSNVFGKCCGPVVGTSPDSWGRSGFRD

Conservation Score

1

PhyloCSF Frame 1

-2.627

No. of Spectra

31

CPC Coding Probability

0.0259847

PhyloCSF Frame 2 

-3.106

CNTI Index

noncoding

Max Probability

0.9987

PhyloCSF Frame 3

-2.993

CNTI Score

-0.335412119