McDonnell Genome Institute

Washington University

Transcript

lnc-WNT4-6:1

Chromosome

chr1

Gene Name

lnc-WNT4-6

Start

22364629

CPC Label

noncoding

End

22366482

Cancer

HCC

Strand

-

Peptide

KVPEGGK

Modified Peptide

KVPEGGK

Peptide Length

7

ORF Length

80

Open Reading Frame (ORF)

LVGNTAKPCQTGKAGMGEGASLGEAIVQCHGKRPPAVSVLKHHRALMDGRTQVCGGTGGWGTWDRATWAGRKVPEGGKVA

Conservation Score

0.702

PhyloCSF Frame 1

0

No. of Spectra

37

CPC Coding Probability

0.325917

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9984

PhyloCSF Frame 3

0

CNTI Score

-0.343431106