McDonnell Genome Institute

Washington University

Transcript

lnc-WNT4-1:5

Chromosome

chr1

Gene Name

lnc-WNT4-1

Start

22410974

CPC Label

noncoding

End

22418964

Cancer

CCRC

Strand

-

Peptide

HGAGVSVSEMGR

Modified Peptide

n[230]HGAGVSVSEMGR

Peptide Length

12

ORF Length

51

Open Reading Frame (ORF)

LCKHGAGVSVSEMGRGLQALSDQLPSAASQQMYLSLLGKKDLQQRWGAESP

Conservation Score

0.301

PhyloCSF Frame 1

-4.541

No. of Spectra

360

CPC Coding Probability

0.133395

PhyloCSF Frame 2 

-4.126

CNTI Index

noncoding

Max Probability

0.9959

PhyloCSF Frame 3

-3.808

CNTI Score

-0.335008802