McDonnell Genome Institute

Washington University

Transcript

lnc-WNT3-1:1

Chromosome

chr17

Gene Name

lnc-WNT3-1

Start

46830591

CPC Label

noncoding

End

46833242

Cancer

OV

Strand

-

Peptide

GPVPTMASVTR

Modified Peptide

n[145]GPVPTM[147]ASVTR

Peptide Length

11

ORF Length

79

Open Reading Frame (ORF)

LTSLWIGSQGHELVLSTTLPLFLLFPGCVVDSSGTQQSLRCRDSPQVPRHSLKGPVPTMASVTRTRSQNAGFWDLSAPF

Conservation Score

0.422

PhyloCSF Frame 1

-4.621

No. of Spectra

2

CPC Coding Probability

0.0276402

PhyloCSF Frame 2 

-1.433

CNTI Index

noncoding

Max Probability

0.9185

PhyloCSF Frame 3

-2.977

CNTI Score

-0.347013984