McDonnell Genome Institute

Washington University

Transcript

lnc-WNT10A-4:1

Chromosome

chr2

Gene Name

lnc-WNT10A-4

Start

218909159

CPC Label

noncoding

End

218929969

Cancer

OSCC

Strand

+

Peptide

GGAASVVSEMPR

Modified Peptide

n[145]GGAASVVSEM[147]PR

Peptide Length

12

ORF Length

35

Open Reading Frame (ORF)

MGGAASVVSEMPRRHFPHCLGYLTLLYLCKLLQQA

Conservation Score

0.861

PhyloCSF Frame 1

0

No. of Spectra

14

CPC Coding Probability

0.22786

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7478

PhyloCSF Frame 3

0

CNTI Score

-0.334265385