McDonnell Genome Institute

Washington University

Transcript

lnc-WISP3-2:2

Chromosome

chr6

Gene Name

lnc-WISP3-2

Start

111873616

CPC Label

noncoding

End

111875487

Cancer

CRC

Strand

+

Peptide

RGNAQQITMR

Modified Peptide

RGNAQQITM[147]R

Peptide Length

10

ORF Length

45

Open Reading Frame (ORF)

LKRGNAQQITMRRRRRLGSFYQSPISADTHLYFFSSKSLEEVLLK

Conservation Score

0.705

PhyloCSF Frame 1

-2.054

No. of Spectra

1

CPC Coding Probability

0.0371652

PhyloCSF Frame 2 

-3.86

CNTI Index

noncoding

Max Probability

0.7215

PhyloCSF Frame 3

-3.759

CNTI Score

-0.348358171