McDonnell Genome Institute

Washington University

Transcript

lnc-WISP1-9:1

Chromosome

chr8

Gene Name

lnc-WISP1-9

Start

133054958

CPC Label

noncoding

End

133057767

Cancer

LUAD

Strand

+

Peptide

LQAGFER

Modified Peptide

n[230]LQAGFER

Peptide Length

7

ORF Length

56

Open Reading Frame (ORF)

LGWDPGICISVTSQGILMQVVRRPLTEKLQAGFERSLPPSSFPEPHPPPSFHWATM

Conservation Score

0.628

PhyloCSF Frame 1

-2.591

No. of Spectra

2

CPC Coding Probability

0.0451812

PhyloCSF Frame 2 

-3.168

CNTI Index

noncoding

Max Probability

0.9944

PhyloCSF Frame 3

-5.367

CNTI Score

-0.285598319