McDonnell Genome Institute

Washington University

Transcript

lnc-WIPF3-1:2

Chromosome

chr7

Gene Name

lnc-WIPF3-1

Start

29684641

CPC Label

noncoding

End

29687892

Cancer

OV

Strand

+

Peptide

GAAGLVIIASWYR

Modified Peptide

n[145]GAAGLVIIASWYR

Peptide Length

13

ORF Length

101

Open Reading Frame (ORF)

LRVLRAAAAVRDAERGLRREGPRRHAPPRKQLRGRRGAAGLVIIASWYRTSMGILNLFGLETNTCWNVTRIEPLNEVQSCEGMFLPKMLSFVNIHKHLIIL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

17

CPC Coding Probability

0.0282569

PhyloCSF Frame 2 

6.941

CNTI Index

noncoding

Max Probability

0.9816

PhyloCSF Frame 3

0

CNTI Score

-0.279735353