McDonnell Genome Institute

Washington University

Transcript

lnc-WIPF3-1:1

Chromosome

chr7

Gene Name

lnc-WIPF3-1

Start

29650226

CPC Label

coding

End

29742594

Cancer

OV

Strand

+

Peptide

ISYLNMAIILK

Modified Peptide

n[145]ISYLNMAIILK

Peptide Length

11

ORF Length

254

Open Reading Frame (ORF)

MTSPTEMGLYYSYFKNNIEASSFLEGLWMIMNDRLTEYPLVINTVKRFHLYPEVIIASWYRTSMGILNLFGLETNTCWNVTRIEPLNEVQSCEGLGDPACFYVGVVFILNGLMMGLFFVYGAYLSGTQLGGLITVLCCFFNHGEVTRVMWTPPLRESFSYPFLVLQMYILTLILRTSSNDRRPFIALCLSNVAFMLPWQFAQFILFTQIASLFPMYVVGYIKPSKFQKISYLNMAIILKEIKFKNWEYLNSTFG

Conservation Score

1

PhyloCSF Frame 1

11.891

No. of Spectra

2

CPC Coding Probability

0.999456

PhyloCSF Frame 2 

8.484

CNTI Index

coding

Max Probability

0.9597

PhyloCSF Frame 3

9.117

CNTI Score

0.573815578