McDonnell Genome Institute

Washington University

Transcript

lnc-WIF1-6:32

Chromosome

chr12

Gene Name

lnc-WIF1-6

Start

65544237

CPC Label

noncoding

End

65557311

Cancer

EOGC

Strand

-

Peptide

LQLNGLSLQEALGVSDLLR

Modified Peptide

n[145]LQLNGLSLQEALGVSDLLR

Peptide Length

19

ORF Length

60

Open Reading Frame (ORF)

LRCRLQLNGLSLQEALGVSDLLRLSLCPTLSRVHLSMILENSMEKEKLRPVFLLRSPSIY

Conservation Score

0.09

PhyloCSF Frame 1

-5.173

No. of Spectra

200

CPC Coding Probability

0.0177374

PhyloCSF Frame 2 

-4.353

CNTI Index

noncoding

Max Probability

0.9988

PhyloCSF Frame 3

-5.496

CNTI Score

-0.342053407