McDonnell Genome Institute

Washington University

Transcript

lnc-WIF1-6:13

Chromosome

chr12

Gene Name

lnc-WIF1-6

Start

65558430

CPC Label

noncoding

End

65642372

Cancer

OV

Strand

-

Peptide

LTMWETK

Modified Peptide

n[145]LTM[147]WETK

Peptide Length

7

ORF Length

34

Open Reading Frame (ORF)

LVEHRSQTFSLGAGRDAGKFCPGKIKLTMWETKK

Conservation Score

0.425

PhyloCSF Frame 1

-5.69

No. of Spectra

3

CPC Coding Probability

0.0553733

PhyloCSF Frame 2 

-6.025

CNTI Index

noncoding

Max Probability

0.8366

PhyloCSF Frame 3

-4.986

CNTI Score

-0.325475613