McDonnell Genome Institute

Washington University

Transcript

lnc-WFS1-3:15

Chromosome

chr4

Gene Name

lnc-WFS1-3

Start

6222071

CPC Label

noncoding

End

6237390

Cancer

EOGC

Strand

+

Peptide

ASLGWDLGAR

Modified Peptide

n[145]ASLGWDLGAR

Peptide Length

10

ORF Length

135

Open Reading Frame (ORF)

LREAAVRWLDLRPPPPLSRVPCSPVRASLGWDLGARRSAADNSRAVPVRWHVARACPPGLAASRRVPRCRCLARAPPSPPGAACAEGATPRAPEPASAKSRPAARRSGPLLRADGDARSQATPVLRASETGSGLV

Conservation Score

0.121

PhyloCSF Frame 1

-3.455

No. of Spectra

80

CPC Coding Probability

0.150999

PhyloCSF Frame 2 

-3.718

CNTI Index

noncoding

Max Probability

0.9982

PhyloCSF Frame 3

0

CNTI Score

-0.264567162