McDonnell Genome Institute

Washington University

Transcript

lnc-WFS1-1:1

Chromosome

chr4

Gene Name

lnc-WFS1-1

Start

6313758

CPC Label

coding

End

6317940

Cancer

CCRC

Strand

+

Peptide

GAQLVSGR

Modified Peptide

n[230]GAQLVSGR

Peptide Length

8

ORF Length

50

Open Reading Frame (ORF)

LVSHLCPCQCQGAWAVGKGGIEALSSGGFSGAKGAQLVSGRERCEQRLGK

Conservation Score

0.334

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.856944

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

0

CNTI Score

-0.372639866