McDonnell Genome Institute

Washington University

Transcript

lnc-WDR91-4:2

Chromosome

chr7

Gene Name

lnc-WDR91-4

Start

135246633

CPC Label

noncoding

End

135317733

Cancer

OSCC

Strand

-

Peptide

KSETDLGSQK

Modified Peptide

n[145]KSETDLGSQK

Peptide Length

10

ORF Length

110

Open Reading Frame (ORF)

LRQENEVNPGARACSEPRSRHCTPAWATERDSVSKKKKREKRKSETDLGSQKANCTSNLLNAKPWCPQARARVVPVPHPRHPGGPAHLLGRGDQRAAGPLAVHAAVLHAA

Conservation Score

1

PhyloCSF Frame 1

11.246

No. of Spectra

1

CPC Coding Probability

0.249501

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9931

PhyloCSF Frame 3

0

CNTI Score

-0.305778579