McDonnell Genome Institute

Washington University

Transcript

lnc-WDR87-1:3

Chromosome

chr19

Gene Name

lnc-WDR87-1

Start

37793432

CPC Label

noncoding

End

37817261

Cancer

PRAD

Strand

-

Peptide

ISMVLPSGTR

Modified Peptide

‚Äč

Peptide Length

10

ORF Length

82

Open Reading Frame (ORF)

LEAHPRLQWQFVLSLPVRQSNTICYRKNRISMVLPSGTRETALRAKGHRGLPENPVQLSEALNCRDKLCNWIPVGQCPAARS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0794524

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6658

PhyloCSF Frame 3

0

CNTI Score

-0.423227676