McDonnell Genome Institute

Washington University

Transcript

lnc-WDR73-3:2

Chromosome

chr15

Gene Name

lnc-WDR73-3

Start

84563413

CPC Label

noncoding

End

84571216

Cancer

OV

Strand

-

Peptide

GPAVLGQSQEGAAGSAHMLWTR

Modified Peptide

n[145]GPAVLGQSQEGAAGSAHMLWTR

Peptide Length

22

ORF Length

53

Open Reading Frame (ORF)

MGPAVLGQSQEGAAGSAHMLWTRAPAETGAHRARGGERTRSRRGSSGSTATSR

Conservation Score

1

PhyloCSF Frame 1

-3.747

No. of Spectra

1

CPC Coding Probability

0.0536767

PhyloCSF Frame 2 

-0.465

CNTI Index

noncoding

Max Probability

0.4988

PhyloCSF Frame 3

0.495

CNTI Score

-0.283971165