McDonnell Genome Institute

Washington University

Transcript

lnc-WDR73-3:10

Chromosome

chr15

Gene Name

lnc-WDR73-3

Start

84504506

CPC Label

coding

End

84516847

Cancer

PRAD

Strand

-

Peptide

GGMCLEVEVGPGALR

Modified Peptide

GGMCLEVEVGPGALR

Peptide Length

15

ORF Length

39

Open Reading Frame (ORF)

LRRGGMCLEVEVGPGALRTGWTCLTRSAGSWRESREKTG

Conservation Score

1

PhyloCSF Frame 1

-3.543

No. of Spectra

12

CPC Coding Probability

1

PhyloCSF Frame 2 

-3.932

CNTI Index

coding

Max Probability

1

PhyloCSF Frame 3

-2.686

CNTI Score

0.844346691