McDonnell Genome Institute

Washington University

Transcript

lnc-WDR73-10:6

Chromosome

chr15

Gene Name

lnc-WDR73-10

Start

84630082

CPC Label

noncoding

End

84631459

Cancer

OSCC

Strand

-

Peptide

LIPLTFIQQLGSNSGQAPGSECAVVGEK

Modified Peptide

n[145]LIPLTFIQQLGSNSGQAPGSECAVVGEK

Peptide Length

28

ORF Length

110

Open Reading Frame (ORF)

LAWLVAVVMLYHSVPPPLTYHSHNSSFPACTVLGHSRLIPLTFIQQLGSNSGQAPGSECAVVGEKKRRHSFLLRNAMQRRVHFLKRCHGVMCNPNNYNAVLLNALRNATC

Conservation Score

0.152

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.157781

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8634

PhyloCSF Frame 3

0

CNTI Score

-0.329732466