McDonnell Genome Institute

Washington University

Transcript

lnc-WDR73-10:4

Chromosome

chr15

Gene Name

lnc-WDR73-10

Start

84631897

CPC Label

noncoding

End

84633987

Cancer

OV

Strand

-

Peptide

MLLSDPDLDLLEK

Modified Peptide

n[145]MLLSDPDLDLLEK

Peptide Length

13

ORF Length

83

Open Reading Frame (ORF)

LRERGLCGERQPGLGRASLRSARPAPSAAATASASRAARPRLRRSAGFFLQVFHQGHCLLSTLRMLLSDPDLDLLEKDSRELF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0158854

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8927

PhyloCSF Frame 3

0

CNTI Score

-0.264847198