McDonnell Genome Institute

Washington University

Transcript

lnc-WDR70-7:5

Chromosome

chr5

Gene Name

lnc-WDR70-7

Start

37839653

CPC Label

noncoding

End

37954158

Cancer

OSCC

Strand

+

Peptide

HLVDALMLPDR

Modified Peptide

n[145]HLVDALMLPDR

Peptide Length

11

ORF Length

67

Open Reading Frame (ORF)

LTALCCVWARGRPSLCPLEPDVFPALNLLWFLSSTSPVRLSHNTQRHLVDALMLPDRGRPTGKSAPR

Conservation Score

0.998

PhyloCSF Frame 1

-2.537

No. of Spectra

12

CPC Coding Probability

0.112714

PhyloCSF Frame 2 

-3.546

CNTI Index

coding

Max Probability

0.8535

PhyloCSF Frame 3

-5.128

CNTI Score

0.694911926