McDonnell Genome Institute

Washington University

Transcript

lnc-WDR70-7:4

Chromosome

chr5

Gene Name

lnc-WDR70-7

Start

37839653

CPC Label

noncoding

End

37883630

Cancer

OSCC

Strand

+

Peptide

MISLFLEGFLLGMISPSK

Modified Peptide

n[145]MISLFLEGFLLGM[147]ISPSK

Peptide Length

18

ORF Length

62

Open Reading Frame (ORF)

MISLFLEGFLLGMISPSKHLQISSTCCVPGKVLGPGHCADWAFFLGGGRGLQGTDTTEVYPQ

Conservation Score

0.992

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.477481

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.6914

PhyloCSF Frame 3

0

CNTI Score

0.729054103