McDonnell Genome Institute

Washington University

Transcript

lnc-WDR70-7:2

Chromosome

chr5

Gene Name

lnc-WDR70-7

Start

37839653

CPC Label

noncoding

End

37883630

Cancer

LUAD

Strand

+

Peptide

IFETNNLR

Modified Peptide

‚Äč

Peptide Length

8

ORF Length

54

Open Reading Frame (ORF)

LEKCGLGLANCKIFETNNLRCFAQRTARLDLPFPSIYVSFSDSAHIPILVWVLS

Conservation Score

1

PhyloCSF Frame 1

-4.174

No. of Spectra

4

CPC Coding Probability

0.112714

PhyloCSF Frame 2 

-3.536

CNTI Index

coding

Max Probability

0.9953

PhyloCSF Frame 3

-2.614

CNTI Score

0.694701573