McDonnell Genome Institute

Washington University

Transcript

lnc-WDR7-3:1

Chromosome

chr18

Gene Name

lnc-WDR7-3

Start

57045583

CPC Label

noncoding

End

57049311

Cancer

EOGC

Strand

+

Peptide

ALCQAVAPGRPSAR

Modified Peptide

n[145]ALCQAVAPGRPSAR

Peptide Length

14

ORF Length

102

Open Reading Frame (ORF)

LVKAKRQPCSFAASYGTSWRAVTDGENAASLPGRTAASGQGSGGWTGRPHGPGSRKALCQAVAPGRPSARLWLRVAWPGAWLQMPPHPPAAGLGAGTDYILR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.199163

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3

PhyloCSF Frame 3

0

CNTI Score

-0.318903298