McDonnell Genome Institute

Washington University

Transcript

lnc-WDR63-6:1

Chromosome

chr1

Gene Name

lnc-WDR63-6

Start

85201170

CPC Label

noncoding

End

85203495

Cancer

PRAD

Strand

+

Peptide

EGVGEGGGAATR

Modified Peptide

‚Äč

Peptide Length

12

ORF Length

99

Open Reading Frame (ORF)

LDSVLLRGSAIPSALAARLTPARGRGRSPAGEKTALAEAEAEAAAAPHDRRWPSPAPHILGITLPREGVGEGGGAATRMPRSPGPRRGARAGGGRVNAC

Conservation Score

1

PhyloCSF Frame 1

-1.79

No. of Spectra

5

CPC Coding Probability

0.0357086

PhyloCSF Frame 2 

0.864

CNTI Index

coding

Max Probability

0.9956

PhyloCSF Frame 3

0.742

CNTI Score

0.737879106