McDonnell Genome Institute

Washington University

Transcript

lnc-WDR61-2:1

Chromosome

chr15

Gene Name

lnc-WDR61-2

Start

78438203

CPC Label

noncoding

End

78438852

Cancer

HCC

Strand

-

Peptide

VGIGSPSFR

Modified Peptide

n[230]VGIGSPSFR

Peptide Length

9

ORF Length

119

Open Reading Frame (ORF)

LRETRTRRRRPPPSSLANGGRAGEDGGPLPAPGVADGGQEAAGSRQRPPEREGCGSRPAVGWPALRVSRRRVGIGSPSFRGLGSKGGPAGRPRGEHNPSPEGLGACRATPGEKSKEFGA

Conservation Score

0.99

PhyloCSF Frame 1

-2.397

No. of Spectra

1

CPC Coding Probability

0.0402742

PhyloCSF Frame 2 

-2.282

CNTI Index

noncoding

Max Probability

0.6953

PhyloCSF Frame 3

-0.481

CNTI Score

-0.278868527