McDonnell Genome Institute

Washington University

Transcript

lnc-WDR6-2:1

Chromosome

chr3

Gene Name

lnc-WDR6-2

Start

49000528

CPC Label

noncoding

End

49000868

Cancer

OV

Strand

+

Peptide

MLLLWKCLGLPECGLPR

Modified Peptide

n[145]MLLLWKCLGLPECGLPR

Peptide Length

17

ORF Length

40

Open Reading Frame (ORF)

MLLLWKCLGLPECGLPRCEAQVLAPPSHLPAVPGVQAASH

Conservation Score

0.07

PhyloCSF Frame 1

-4.198

No. of Spectra

5

CPC Coding Probability

0.0154704

PhyloCSF Frame 2 

-4.404

CNTI Index

noncoding

Max Probability

0.5082

PhyloCSF Frame 3

-5.402

CNTI Score

-0.341171157