McDonnell Genome Institute

Washington University

Transcript

lnc-WDR5-4:2

Chromosome

chr9

Gene Name

lnc-WDR5-4

Start

134164982

CPC Label

noncoding

End

134169532

Cancer

OV

Strand

+

Peptide

DLGGHSTLSDLAQNPWK

Modified Peptide

n[145]DLGGHSTLSDLAQNPWK

Peptide Length

17

ORF Length

60

Open Reading Frame (ORF)

LGGQGWKDLGGHSTLSDLAQNPWKQPAMHGWRWLCPVSAGASGTPALTDAASPADCCIPR

Conservation Score

0.079

PhyloCSF Frame 1

-5.116

No. of Spectra

2

CPC Coding Probability

0.212334

PhyloCSF Frame 2 

-3.431

CNTI Index

noncoding

Max Probability

0.9092

PhyloCSF Frame 3

-4.403

CNTI Score

-0.323140921