McDonnell Genome Institute

Washington University

Transcript

lnc-WDR41-4:1

Chromosome

chr5

Gene Name

lnc-WDR41-4

Start

77073639

CPC Label

noncoding

End

77076544

Cancer

OV

Strand

-

Peptide

HCTAFLLPAK

Modified Peptide

n[145]HCTAFLLPAK

Peptide Length

10

ORF Length

58

Open Reading Frame (ORF)

MLGACSAKSISTKHCTAFLLPAKLRAHLSCIFPSLSPPTVPYLSHNFAKAKGIVLSQC

Conservation Score

0.921

PhyloCSF Frame 1

-3.424

No. of Spectra

1

CPC Coding Probability

0.0843748

PhyloCSF Frame 2 

-4.811

CNTI Index

noncoding

Max Probability

0.288

PhyloCSF Frame 3

-5.219

CNTI Score

-0.384204866