McDonnell Genome Institute

Washington University

Transcript

lnc-WDR4-2:6

Chromosome

chr21

Gene Name

lnc-WDR4-2

Start

42944424

CPC Label

noncoding

End

42955810

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

GAGGIYIK

Modified Peptide

n[145]GAGGIYIK

Peptide Length

8

ORF Length

70

Open Reading Frame (ORF)

MAQMHSICSGNCFANKKKKKRGKRITFRGNLIVSTSHQFRSILREKKKKRKKKGAGGIYIKRVLYGKFLS

Conservation Score

0

PhyloCSF Frame 1

0

No. of Spectra

26

CPC Coding Probability

0.373307

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9972

PhyloCSF Frame 3

0

CNTI Score

-0.317773382