McDonnell Genome Institute

Washington University

Transcript

lnc-WDR4-2:5

Chromosome

chr21

Gene Name

lnc-WDR4-2

Start

42909599

CPC Label

coding

End

42955810

Cancer

BRCA-Luminal A

Strand

-

Peptide

VGQLEAKAGTLQAGR

Modified Peptide

n[145]VGQLEAKAGTLQAGR

Peptide Length

15

ORF Length

177

Open Reading Frame (ORF)

LEDTYPLKIKREVALVLHSSHVRLGQFLFTEDYKTPAPSSLGADAILGLSLSACRRSLKQHVAPHRLMLSVGALSGFQPMQEPCTDDMSPGWLGHSLVLYILGRYETPINICKKHLGSSGKVGQLEAKAGTLQAGRELAGHRKVRHWRLHSFEFLISLSKGGNEICIYLSEQRSDFE

Conservation Score

0.512

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.5

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.993

PhyloCSF Frame 3

0

CNTI Score

0.645362444