McDonnell Genome Institute

Washington University

Transcript

lnc-WDR4-1:3

Chromosome

chr21

Gene Name

lnc-WDR4-1

Start

42827613

CPC Label

coding

End

42838647

Cancer

OV

Strand

-

Peptide

VQPGQHGETPQSTK

Modified Peptide

n[145]VQPGQHGETPQSTK

Peptide Length

14

ORF Length

180

Open Reading Frame (ORF)

MIVPLHCSLGKRTRLLSQKKRKRQNQQFLTSHKCTDGQAILLLDIYPRRMKAMSLKRFAQKCSQQFHSQQLQTGNKPNVQFDLSKNQIPAHSSKGIYTALKGSRRAGCSGSRMYSQHFGRPRWVDHLRSGVRVQPGQHGETPQSTKNTKISQAWWRMPVIPATWEAEAGESPEPGRRRLR

Conservation Score

0.345

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.904345

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6801

PhyloCSF Frame 3

0

CNTI Score

-0.290976343