McDonnell Genome Institute

Washington University

Transcript

lnc-WDR4-1:1

Chromosome

chr21

Gene Name

lnc-WDR4-1

Start

42835528

CPC Label

noncoding

End

42837695

Cancer

BRCA-Luminal B

Strand

-

Peptide

ILMDTVSK

Modified Peptide

n[145]ILMDTVSK

Peptide Length

8

ORF Length

52

Open Reading Frame (ORF)

LENRILMDTVSKFKDKKNWTEYWRSSLSNSRLLGCAAQDSFECGPTQICKLS

Conservation Score

0.467

PhyloCSF Frame 1

0

No. of Spectra

13

CPC Coding Probability

0.123829

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9964

PhyloCSF Frame 3

0

CNTI Score

-0.290976343