McDonnell Genome Institute

Washington University

Transcript

lnc-WDR33-1:1

Chromosome

chr2

Gene Name

lnc-WDR33-1

Start

127699248

CPC Label

noncoding

End

127700789

Cancer

OV

Strand

-

Peptide

LDSATPR

Modified Peptide

n[145]LDSATPR

Peptide Length

7

ORF Length

77

Open Reading Frame (ORF)

LDSATPRCPDSSSHHCDKLARTQVNPDLFPGRTHVPCCFSEPPRGCLLVVPLTALQPGLRSTVPAKLFITKSPDAVG

Conservation Score

0.117

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.00000191

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8216

PhyloCSF Frame 3

0

CNTI Score

-0.417987459