McDonnell Genome Institute

Washington University

Transcript

lnc-WDR26-1:2

Chromosome

chr1

Gene Name

lnc-WDR26-1

Start

224608296

CPC Label

noncoding

End

224616060

Cancer

OV

Strand

-

Peptide

LNAAAAPPGSCSFAYR

Modified Peptide

n[145]LNAAAAPPGSCSFAYR

Peptide Length

16

ORF Length

59

Open Reading Frame (ORF)

LRKGMVCASRLNAAAAPPGSCSFAYRSGKCGDLGRCLVLVGDTVQALDPKAAWMDFTKL

Conservation Score

0.999

PhyloCSF Frame 1

-0.267

No. of Spectra

1

CPC Coding Probability

0.0448138

PhyloCSF Frame 2 

0.79

CNTI Index

noncoding

Max Probability

0.884

PhyloCSF Frame 3

-0.494

CNTI Score

-0.388688565