McDonnell Genome Institute

Washington University

Transcript

lnc-WDR11-3:1

Chromosome

chr10

Gene Name

lnc-WDR11-3

Start

120979388

CPC Label

noncoding

End

120981176

Cancer

EOGC

Strand

+

Peptide

AATLLTPNRR

Modified Peptide

n[145]AATLLTPNRR

Peptide Length

10

ORF Length

46

Open Reading Frame (ORF)

MEKQNLLILNSQNRIFLGSGKPLPHPFPLSIPPSRRAATLLTPNRR

Conservation Score

0.082

PhyloCSF Frame 1

-2.248

No. of Spectra

62

CPC Coding Probability

0.0324255

PhyloCSF Frame 2 

-4.891

CNTI Index

noncoding

Max Probability

0.9985

PhyloCSF Frame 3

-4.39

CNTI Score

-0.390754762