McDonnell Genome Institute

Washington University

Transcript

lnc-WDR11-1:3

Chromosome

chr10

Gene Name

lnc-WDR11-1

Start

120818232

CPC Label

noncoding

End

120825291

Cancer

BRCA-Basal-like

Strand

+

Peptide

IYCAILNLK

Modified Peptide

n[145]IYCAILNLK

Peptide Length

9

ORF Length

131

Open Reading Frame (ORF)

LEPVNMLPYMAKGTYFADMIKRDSEGVRVKEDNMTTSQEGFEDATLLALKGARARESKECSSSSWKGHSSPLEPLEGAQPCQHRRFSPDAPFQTSDLQNYKRIYCAILNLKVCGHLFQQQQETNLSTKHCI

Conservation Score

0.213

PhyloCSF Frame 1

-3.516

No. of Spectra

10

CPC Coding Probability

0.455434

PhyloCSF Frame 2 

-4.535

CNTI Index

noncoding

Max Probability

0.8462

PhyloCSF Frame 3

-4.945

CNTI Score

-0.348996878