McDonnell Genome Institute

Washington University

Transcript

lnc-WDR1-1:2

Chromosome

chr4

Gene Name

lnc-WDR1-1

Start

10068090

CPC Label

noncoding

End

10073019

Cancer

HCC

Strand

-

Peptide

NLNSVFR

Modified Peptide

n[230]NLNSVFR

Peptide Length

7

ORF Length

44

Open Reading Frame (ORF)

LEIHKENGLPQIHSWKRNKNLNSVFRELDFYPWHYTKIQQVKIS

Conservation Score

0.036

PhyloCSF Frame 1

-4.244

No. of Spectra

2

CPC Coding Probability

0.134955

PhyloCSF Frame 2 

-3.147

CNTI Index

noncoding

Max Probability

0.997

PhyloCSF Frame 3

-4.67

CNTI Score

-0.301812092