McDonnell Genome Institute

Washington University

Transcript

lnc-WDPCP-1:16

Chromosome

chr2

Gene Name

lnc-WDPCP-1

Start

63043418

CPC Label

coding

End

63046566

Cancer

OV

Strand

-

Peptide

GNSILYLQIK

Modified Peptide

n[145]GNSILYLQIK

Peptide Length

10

ORF Length

43

Open Reading Frame (ORF)

MCWFKSPPTPSKAKFIQDSKLLSSFMKANGARGNSILYLQIKN

Conservation Score

1

PhyloCSF Frame 1

-3.061

No. of Spectra

1

CPC Coding Probability

0.567417

PhyloCSF Frame 2 

-4.2

CNTI Index

coding

Max Probability

0.9265

PhyloCSF Frame 3

-3.957

CNTI Score

0.650661055