McDonnell Genome Institute

Washington University

Transcript

lnc-WASHC5-5:2

Chromosome

chr8

Gene Name

lnc-WASHC5-5

Start

125003869

CPC Label

noncoding

End

125009074

Cancer

OV

Strand

-

Peptide

DAQLVSIMQTSEK

Modified Peptide

n[145]DAQLVSIM[147]QTSEK

Peptide Length

13

ORF Length

62

Open Reading Frame (ORF)

LSSNVTNKILIRSFQISDFQIRDAQLVSIMQTSEKNKKSETLLIPSISDKRYSTCKPVSLLF

Conservation Score

0.375

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0512945

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7353

PhyloCSF Frame 3

0

CNTI Score

-0.360226267