McDonnell Genome Institute

Washington University

Transcript

lnc-WASHC5-13:3

Chromosome

chr8

Gene Name

lnc-WASHC5-13

Start

125423592

CPC Label

noncoding

End

125429794

Cancer

OV

Strand

-

Peptide

ALSVLPILK

Modified Peptide

n[145]ALSVLPILK

Peptide Length

9

ORF Length

57

Open Reading Frame (ORF)

MHGSNVRKALSVLPILKWKSLEARAPSFHLPVSRHMRLCSHTQRVCVQCIMLPDLTF

Conservation Score

0.116

PhyloCSF Frame 1

-5.153

No. of Spectra

1

CPC Coding Probability

0.183503

PhyloCSF Frame 2 

-3.925

CNTI Index

noncoding

Max Probability

0.9926

PhyloCSF Frame 3

-4.842

CNTI Score

-0.294192311