McDonnell Genome Institute

Washington University

Transcript

lnc-WASF3-3:1

Chromosome

chr13

Gene Name

lnc-WASF3-3

Start

26389754

CPC Label

noncoding

End

26393231

Cancer

LUAD

Strand

+

Peptide

HMPVCSAK

Modified Peptide

n[230]HMPVCSAK

Peptide Length

8

ORF Length

79

Open Reading Frame (ORF)

LLCCQGWIQTPGLKRSSRLSLLSSWDYRHMPVCSAKSSVALIIAKLLTFHLPLHILFSSLEFLITNQMNCYSVYWVCCK

Conservation Score

0.343

PhyloCSF Frame 1

0

No. of Spectra

15

CPC Coding Probability

0.0166716

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9791

PhyloCSF Frame 3

0

CNTI Score

-0.354652122