McDonnell Genome Institute

Washington University

Transcript

lnc-WARS2-6:1

Chromosome

chr1

Gene Name

lnc-WARS2-6

Start

119369998

CPC Label

noncoding

End

119379295

Cancer

OV

Strand

-

Peptide

GSPGDQLILCKE

Modified Peptide

n[145]GSPGDQLILCKE

Peptide Length

12

ORF Length

55

Open Reading Frame (ORF)

MTSLQHETLGIESLLTCSAILHPQEGKAVRERPLGFPKRHLEKGSPGDQLILCKE

Conservation Score

0.266

PhyloCSF Frame 1

-6.104

No. of Spectra

3

CPC Coding Probability

0.0262631

PhyloCSF Frame 2 

-5.062

CNTI Index

noncoding

Max Probability

0.2275

PhyloCSF Frame 3

-5.906

CNTI Score

-0.363946767