McDonnell Genome Institute

Washington University

Transcript

lnc-WARS2-4:1

Chromosome

chr1

Gene Name

lnc-WARS2-4

Start

119219313

CPC Label

noncoding

End

119220096

Cancer

EOGC

Strand

-

Peptide

IPFSWHVRK

Modified Peptide

n[145]IPFSWHVRK

Peptide Length

9

ORF Length

200

Open Reading Frame (ORF)

MYSRKATYKRKYSATKSKVEKKKKLLATVTKPVSGDKNGGIWVIKLHKMPRYYPTEDVPQKLLSHGKIPFSWHVRKLRASITPRTILIILIGHHRSKRVVFLKQLASGLVGTCDWTSGPQSSSSTKNTPEICHCTSTRIDISNVKTPKHLTDAYFTKKKLQKPRHQEGEILDTEKEKYEITEQCKIDQKAADSQILQKSK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.263529

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.1544

PhyloCSF Frame 3

0

CNTI Score

0.685017866