McDonnell Genome Institute

Washington University

Transcript

lnc-WARS-3:1

Chromosome

chr14

Gene Name

lnc-WARS-3

Start

100293586

CPC Label

noncoding

End

100294388

Cancer

LUAD

Strand

-

Peptide

REPLHLAR

Modified Peptide

‚Äč

Peptide Length

8

ORF Length

113

Open Reading Frame (ORF)

LLTWVPKEVVGCSLATTLLTHNCCSHERLLAETRQELLEPRSLLLFLFIYLLRWNVPFSPRLECSGMTSLHPLPHGFKQFSHLSLLSSRDYRREPLHLARLITFCAYCLEASL

Conservation Score

0.448

PhyloCSF Frame 1

0

No. of Spectra

25

CPC Coding Probability

0.0238584

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9947

PhyloCSF Frame 3

0

CNTI Score

-0.35002258