McDonnell Genome Institute

Washington University

Transcript

lnc-VWC2L-1:3

Chromosome

chr2

Gene Name

lnc-VWC2L-1

Start

214810228

CPC Label

noncoding

End

214963605

Cancer

OV

Strand

+

Peptide

LNNLFQNDSWVNNEIK

Modified Peptide

n[145]LNNLFQNDSWVNNEIK

Peptide Length

16

ORF Length

121

Open Reading Frame (ORF)

LDQVDLIDIYRTFYPKTTECTFFSLPHVTYSKIDHIIGSKTLLSKCKRTEIITNSLSDHSAIKLEFKIRKFSQNHTTTWKLNNLFQNDSWVNNEIKAEIKKFFETNEKKRECTRISGTQLK

Conservation Score

0.911

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.366981

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0881

PhyloCSF Frame 3

0

CNTI Score

-0.344216977