McDonnell Genome Institute

Washington University

Transcript

lnc-VWA8-1:1

Chromosome

chr13

Gene Name

lnc-VWA8-1

Start

42042489

CPC Label

coding

End

42048728

Cancer

EOGC

Strand

-

Peptide

LVLAIFLNR

Modified Peptide

n[145]LVLAIFLNR

Peptide Length

9

ORF Length

61

Open Reading Frame (ORF)

LSSKENTKLVLAIFLNRTKSPCQTVESLHLEKAFNLCYVHAFQYHSFRIFSVDMTFKVPPN

Conservation Score

0.965

PhyloCSF Frame 1

-4.859

No. of Spectra

75

CPC Coding Probability

0.758228

PhyloCSF Frame 2 

-4.37

CNTI Index

coding

Max Probability

1

PhyloCSF Frame 3

-4.978

CNTI Score

0.646802612