McDonnell Genome Institute

Washington University

Transcript

lnc-VWA5B1-22:1

Chromosome

chr1

Gene Name

lnc-VWA5B1-22

Start

20272017

CPC Label

noncoding

End

20273599

Cancer

OV

Strand

+

Peptide

LQHLPQPLLTVEK

Modified Peptide

n[145]LQHLPQPLLTVEK

Peptide Length

13

ORF Length

47

Open Reading Frame (ORF)

LQHLPQPLLTVEKNKDFPITPLGHQSSMSYWALPEIRFSNWSLHWLQ

Conservation Score

1

PhyloCSF Frame 1

-4.728

No. of Spectra

3

CPC Coding Probability

0.0369172

PhyloCSF Frame 2 

-5.029

CNTI Index

noncoding

Max Probability

0.996

PhyloCSF Frame 3

-4.839

CNTI Score

-0.385372941