McDonnell Genome Institute

Washington University

Transcript

lnc-VTI1A-1:1

Chromosome

chr10

Gene Name

lnc-VTI1A-1

Start

112818804

CPC Label

noncoding

End

112830788

Cancer

OSCC

Strand

+

Peptide

LSRADTCLQVGR

Modified Peptide

n[145]LSRADTCLQVGR

Peptide Length

12

ORF Length

43

Open Reading Frame (ORF)

MFIPPCNPHDCISKGAPLRLSRADTCLQVGRSPSALALLPGLA

Conservation Score

0.047

PhyloCSF Frame 1

0.878

No. of Spectra

6

CPC Coding Probability

0.219316

PhyloCSF Frame 2 

-3.266

CNTI Index

noncoding

Max Probability

0.9977

PhyloCSF Frame 3

-4.242

CNTI Score

-0.297693416